Incretin-related and amylin peptides
Retatrutide
Retatrutide (LY3437943) is a synthetic 39-residue peptide described in the literature as an agonist of the GIP, GLP-1 and glucagon receptors, often called a triple agonist.
- TypePeptide
- Vesta listings12
Reference page for laboratory use · updated 2026-10-30
Overview
Retatrutide at a glance
Retatrutide extends the dual-agonist concept by adding glucagon receptor activity to GIP and GLP-1 receptor activity. Published laboratory methods use it, for example, to measure lipolytic function in cultured human adipocytes.
No PubChem compound record was available when this page was prepared, so the page does not state a formula or molecular weight. Use the batch documents for the exact mass of the supplied material.
Structure
The FDA Global Substance Registration System lists a 39-residue backbone (UNII NOP2Y096GV). The registered record does not describe the non-standard residues and side-chain modifications, so Vesta does not derive a mass from it.
Identity
Identity data
| Name | Retatrutide |
|---|---|
| Also written as | LY3437943 |
| Type | Peptide |
| Research area | Incretin-related and amylin peptides |
| Registered backbone sequence | YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS |
| Registry record | FDA Global Substance Registration System, UNII NOP2Y096GV |
No verified formula or mass is published for this compound on this page because no public compound record was available. Reference data retrieved on 2026-10-30. Compare these values with the batch certificate of analysis, using the compound identity file template.
Quality
Analytical notes for batch documents
- No verified formula is published here on purpose. Compare the molecular weight on the batch COA with the manufacturer's stated value and with the intact mass measured by LC-MS.
- For a lipidated multi-agonist peptide, ask whether the report shows an intact-mass spectrum and a chromatogram with the integration method.
- The molecular weight of a vial of powder includes counter-ions and water; the share of the powder that is peptide is the net peptide content.
Terms used on this page: Lipidation, Peptide.
Vesta listings
Retatrutide formats and prices
| Product | Per vial | SKU | Price per kit | Price per vial |
|---|---|---|---|---|
| Retatrutide | 5 mg | RT5 | $39.18 | $3.92 |
| Retatrutide | 10 mg | RT10 | $67.16 | $6.72 |
| Retatrutide | 15 mg | RT15 | $97.01 | $9.70 |
| Retatrutide | 20 mg | RT20 | $113.81 | $11.38 |
| Retatrutide | 30 mg | RT30 | $152.99 | $15.30 |
| Retatrutide | 40 mg | RT40 | $194.03 | $19.40 |
| Retatrutide | 50 mg | RT50 | $246.27 | $24.63 |
| Retatrutide | 60 mg | RT60 | $283.58 | $28.36 |
| Retatrutide | 80 mg | RT80 | $317.16 | $31.72 |
| Retatrutide | 100 mg | RT100 | $380.60 | $38.06 |
| Retatrutide | 120 mg | RT120 | $451.49 | $45.15 |
Research blends that contain Retatrutide
| Product | Per vial | SKU | Price per kit | Price per vial |
|---|---|---|---|---|
| Retatrutide+Tirzepatide | 60 mg | RET60 | $305.97 | $30.60 |
Prices are per kit of 10 vials in US dollars. Shipping is paid by the customer and is shown in the cart. Volume savings of 5 %, 8 % and 10 % apply from $350.00, $600.00 and $1,000.00. See the full price list.
Published literature
Selected scientific literature
Bibliographic details were read from PubMed on 2026-10-30. The papers are listed for scientific reference; Vesta makes no claim about the use of its research materials in people or animals.
- Differentiation of human subcutaneous adipocytes and measurement of lipolytic function induced by GIP or LY3437943Regmi A, Roell W · STAR Protoc · 2023 · PMID 37178114
- The power of three: Retatrutide's role in modern obesity and diabetes therapyAbdul-Rahman T, Roy P, Ahmed FK et al. · Eur J Pharmacol · 2024 · PMID 39515565
Questions
Frequently asked questions
What is Retatrutide?
Retatrutide (LY3437943) is a synthetic 39-residue peptide described in the literature as an agonist of the GIP, GLP-1 and glucagon receptors, often called a triple agonist.
What is the molecular weight of Retatrutide?
No verified molecular weight is published on this page because no public compound record was available when it was prepared. Use the value stated by the manufacturer and the intact mass measured by LC-MS in the batch documents.
How can I check the identity of a batch of Retatrutide?
Ask for an intact-mass LC-MS result and an HPLC chromatogram for the batch, compare the mass with the manufacturer's stated value, and confirm that the batch code on the report matches the vial.
Which Retatrutide products does Vesta list?
Vesta lists 12 products for Retatrutide: 5 mg, 10 mg, 15 mg, 20 mg, 30 mg, 40 mg, 50 mg, 60 mg, 80 mg, 100 mg, 120 mg per vial in kits of 10 vials, plus 1 research blend that contain it. Prices are shown per kit in US dollars, and shipping is paid by the customer.